Zinc Alpha 2 Glycoprotein (AZGP1) Rabbit Polyclonal Antibody TA344276 from OriGene Technologies | Biocompare.com

Supplier Images

Zinc Alpha 2 Glycoprotein (AZGP1) Rabbit Polyclonal Antibody

Be the first to write a review!

Supplier Page from
OriGene Technologies for
Zinc Alpha 2 Glycoprotein (AZGP1) Rabbit Polyclonal Antibody

OriGene Technologies' Zinc Alpha 2 Glycoprotein (AZGP1) Rabbit Polyclonal Antibody is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Western Blot. The Zinc Alpha 2 Glycoprotein (AZGP1) Rabbit Polyclonal Antibody was generated using AZGP1 as the antigen and it reacts with Human.

Description

Rabbit Polyclonal Anti-AZGP1 Antibody - N-terminal region

Product Specs
ItemZinc Alpha 2 Glycoprotein (AZGP1) Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price Pricing Info Supplier Page View Company Product Page
Catalog NumberTA344276
Quantity100 µl
ApplicationsWB
Conjugate/TagUnconjugated
PurityAffinity Purified
ReactivityHuman
TargetAZGP1
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-AZGP1 antibody: synthetic peptide directed towards the N terminal of human AZGP1. Synthetic peptide located within the following region: MVRMVPVLLSLLLLLGPAVPQENQDGRYSLTYIYTGLSKHVEDVPAFQAL
NCBI Full Gene Namealpha-2-glycoprotein 1, zinc-binding
NCBI Gene AliasesZAG, ZA2G
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!